PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000480581
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 293aa    MW: 33764.6 Da    PI: 8.6161
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000480581genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM151.73.4e-47191453128
            NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..k 96 
                    pGfrFhPt+eel+ +yL+  v gk+l++ ++i  ++iy+++PwdLp   k +e+ewyfF++rd+k+ +g r+nr+t++g+Wkatg+d++++s    
  MDP0000480581  19 PGFRFHPTEEELLEFYLRSMVFGKRLRF-DIIGFLNIYRHDPWDLPGLSKIGEREWYFFVPRDRKHGSGGRPNRTTETGFWKATGSDRKIVSLsdP 113
                    9*************************99.99***************8778899*************************************997666 PP

            NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                    ++ +gl+ktLvfykgrap+g+ktdWvm+eyrl
  MDP0000480581 114 KRIIGLRKTLVFYKGRAPRGSKTDWVMNEYRL 145
                    778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.75E-5717163IPR003441NAC domain
PROSITE profilePS5100554.95717163IPR003441NAC domain
PfamPF023655.5E-2519145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0010200Biological Processresponse to chitin
GO:0045792Biological Processnegative regulation of cell size
GO:0048281Biological Processinflorescence morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MAANTINPYH EMTPEFELPG FRFHPTEEEL LEFYLRSMVF GKRLRFDIIG FLNIYRHDPW  60
DLPGLSKIGE REWYFFVPRD RKHGSGGRPN RTTETGFWKA TGSDRKIVSL SDPKRIIGLR  120
KTLVFYKGRA PRGSKTDWVM NEYRLPDNCQ YLKDIVLCKI YRKATSLKVL EQRAAMEENQ  180
IKDFHASPNS SSPTSMETFS LGSQAIQEAL TPQIPTKHVV FKQEVEDATL VVAQEQKGEN  240
AMEIKGSSHP IYNLPELQVP KFSMDWTQDT VWTQMSSPWL QNLTPLANIL NF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-481916317168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008382468.10.0PREDICTED: NAC transcription factor 29-like
TrEMBLM5VLG71e-170M5VLG7_PRUPE; Uncharacterized protein
STRINGPOPTR_0004s18860.11e-134(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62143251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.11e-117NAC domain containing protein 36